PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe4G224800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family TALE
Protein Properties Length: 317aa    MW: 35567.2 Da    PI: 5.9899
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe4G224800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.7e-092442782155
                        HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
           Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                        k +yps++++  LA+++gL+++q+ +WF N+R ++
  Aqcoe4G224800.1.p 244 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 278
                        569*****************************885 PP

2ELK41.33.1e-14198219122
                ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                        ELK qLlrKYsgyLgsLkqEF+
  Aqcoe4G224800.1.p 198 ELKGQLLRKYSGYLGSLKQEFM 219
                        9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012559.7E-1862106IPR005540KNOX1
PfamPF037903.3E-1964103IPR005540KNOX1
SMARTSM012562.3E-24111162IPR005541KNOX2
PfamPF037914.1E-21115161IPR005541KNOX2
SMARTSM011882.8E-8198219IPR005539ELK domain
PfamPF037895.1E-11198219IPR005539ELK domain
PROSITE profilePS5121311.174198218IPR005539ELK domain
PROSITE profilePS5007112.989218281IPR001356Homeobox domain
SuperFamilySSF466898.13E-20220295IPR009057Homeodomain-like
SMARTSM003895.3E-13220285IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.3E-28223283IPR009057Homeodomain-like
CDDcd000866.63E-12230282No hitNo description
PfamPF059205.6E-17238277IPR008422Homeobox KN domain
PROSITE patternPS000270256279IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEGGGGGGSG FMSFGGDMMM MMPLMTTSST TTNNNTSSNA QTNNLFLPLP SSNTTTTNNN  60
ESNLRAKIIS HPHYPRLLAC YINCQKVGAT PEVITRLEEA CASEEAMSRV GRRNLGEDPG  120
LDQFMEAYCE MLIKYEQELS KPFKEAMLFL SRIESQFKAL TVGSSDSVCG DAFDRNGSSE  180
EEVDGIDSAI DPLAEDRELK GQLLRKYSGY LGSLKQEFMK KRKKGKLPKE ARQQLLDWWS  240
KHYKWPYPSE SQKLALAEST GLDQKQINNW FINQRKRHWK PSEDMQFVVM DAAHPHYYMD  300
NVLGNPFAMD CTSSLL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1213222LKQEFMKKRK
2219223KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8543350.0KC854335.1 Aquilegia coerulea STM1 (STM1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010244154.11e-163PREDICTED: homeobox protein SBH1
SwissprotP466081e-138HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLS5N5I70.0S5N5I7_AQUCA; STM1
STRINGVIT_12s0059g01190.t011e-160(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-127KNOX/ELK homeobox transcription factor